Gold Member Since 2016
Shanghai Shucan Industrial Co., Ltd.

Teriparatide, Teriparatide Acetate, Pharmaceutical Raw Materials manufacturer / supplier in China, offering Polypeptides Hormone Teriparatide Acetate CAS 52232-67-4 for Treat Osteoporosis, 98% CAS 77472-70-9 Muscle Building Sterioids Carphedons for Anti-Amnesic & Antipsychotic, Ibutamoren 159752-10-0 Polypeptide Powder Mk-677 for Muscle Growth and so on.

(/ )

Supplier Homepage Product Pharmaceutical Raw Materials Polypeptides Hormone Teriparatide Acetate CAS 52232-67-4 for Treat Osteoporosis

Polypeptides Hormone Teriparatide Acetate CAS 52232-67-4 for Treat Osteoporosis

Purchase Qty.:
(Bags)
1 2 3+
FOB Unit Price: US $20 US $10 US $5
Purchase Qty. (Bags) FOB Unit Price
1 US $20
2 US $10
3+ US $5
Get Latest Price
Port: Shanghai, China
Production Capacity: 2000kgs Per Month
Payment Terms: T/T, Western Union, Paypal, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: Teriparatide
  • Customized: Non-Customized
  • Suitable for: Elderly, Children, Adult
  • Purity: >99%
  • Minimum Order: Quantity:10g~1kg
  • Lead Time: 4-6working Days
  • Supply Ability: Adequate in Stock
  • Shelf Life: Two Years
  • Contact: Alanyi
  • Transport Package: as Customer Request
  • Origin: Shanghai
  • Powder: Teriparatide
  • Certification: GMP, HSE, ISO 9001, USP, BP
  • State: Solid
  • Delivery Time: Within 12hours After Payment
  • Payment Terms: Western Union, Moneygram, T/T, Bitcoin
  • Delivery: Priority to The Use of DHL, TNT, FedEx, Hkems, UPS
  • Storage: Ventilation Low Temperature Drying
  • CAS: 00-00-0
  • Trademark: ShuCan
  • Specification: 10gram
  • HS Code: 1501000000
Product Description
Basic View:
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 
1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);
TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS : 52232-67-4
Purity (HPLC : Ge; 98.5% 
MF : C172H278N52O47S2
MW : 3890.49792
Product Categories : Amino Acid Derivatives;Peptide;Hormones
Usage : A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
 

Applications:
 1. APIs; Teriparatide is indicated for use in postmenopausal women with osteoporosis at a high risk for
 fracture or with a history of ostoporotic fracture, patients with multiple risk factors for fracture, and for 
patients who have failed or are intolerant to other available osteoporosis therapy.
2. Teriparatide is also indicated to increase bone mass in men with primary or hypogonadal osteoporosi
s at high risk of fracture, patients with multiple risk factors for fracture, and for patients who have failed 
or are intolerant to other available osteoporosis therapy.
Teriparatide is indicated as well for the treatment of men and women with osteoporosis associated with 
sustained systemic glucocorticoid therapy.
3. Teriparatide should not be prescribed for patients who are at increased risks for osteosarcoma. 
This includes those with Paget's Disease of bone or unexplained elevations of serum alkaline phosphate, 
open epiphysis, or prior radiation therapy involving the skeleton
 
Packaging & Delivery Strategies:
1.   Sufficient stock, to delivery promptly at the very day when receive the payment
2.   Sophisticated and professional logistic agent.
3.  Well-trained and disciplined packing team. Unique ways to ship 2 mgial to 20mgial at one time to your destination. Fast and discreet shipment could be arranged for customs pass Guaranteed.
4.   Packing pictures and tacking code are provided within 12 hours after receiving the payment. Updated
 tracking information will be provided every other day.
5.   After-sale service: Any questions or problems after receiving the product, please feel free to contact us. Problems would be solved immediately.
 
Products Customization:
1. 0.5mg CJC with DAC + 0.5mg 
2. Hexarelin + 1mg Ipamorelin
3. Ghrp-6  1mg+Ipamorelin 
4. 1mg+CjC-12951mg+MGF 500mcg
We can mix different polypeptides according to your requirement.
 

Related  products
Polypeptide Series
 Product NameSpecification
MGF2mg/vial
PEG MGF2mg/vial
CJC-1295 with DAC2mg/vial
CJC-1295 without DAC2mg/vial
PT-14110mg/vial
MT-110mg/vial
MT-210mg/vial
GHRP-210mg/vial
GHRP-25mg/vial
GHRP-610mg/vial
GHRP-65mg/vial
 2mg/vial
Hexarelin2mg/vial
Sermorelin2mg/vial
Oxytocin2mg/vial
 TB5002mg/vial
pentadecapeptide BPC 1572mg/vial
 2mg/vial
 2mg/vial
Tesamorelin2mg/vial
 2mg/vial
 10mg/vial
 2mg/vial
 5mg/vial

Our Strengths:

1. Offer best quanlity and competitive price.
2. well experienced in delivering the parcels to you.
3. Full stock ensures prompt delivery.
4. Superior after-sales service.
5. Package will be reshipped if sent unseccessfully.
6. Experiential shopping .Besides raw steroid powder and liquid, we offer steroid solutions and recipes. 
We can teach you how to make steroid solutions on the site. Any visit to our lab is welcomed.
 
Send your message to this supplier
Avatar
Ms. Alan +86-17301859715
*From:
To: Ms. Alan +86-17301859715
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category